Reaction Details |
| Report a problem with these data |
Target | Placenta growth factor |
---|
Ligand | BDBM50339203 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_736109 (CHEMBL1692892) |
---|
IC50 | >1000±n/a nM |
---|
Citation | Bower, KE; Lam, SN; Oates, BD; Del Rosario, JR; Corner, E; Osothprarop, TF; Kinhikar, AG; Hoye, JA; Preston, RR; Murphy, RE; Campbell, LA; Huang, H; Jimenez, J; Cao, X; Chen, G; Ainekulu, ZW; Datt, AB; Levin, NJ; Doppalapudi, VR; Pirie-Shepherd, SR; Bradshaw, C; Woodnutt, G; Lappe, RW Evolution of potent and stable placental-growth-factor-1-targeting CovX-bodies from phage display peptide discovery. J Med Chem54:1256-65 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Placenta growth factor |
---|
Name: | Placenta growth factor |
Synonyms: | PLGF_MOUSE | Pgf | Plgf |
Type: | PROTEIN |
Mol. Mass.: | 17879.06 |
Organism: | Mus musculus |
Description: | ChEMBL_736103 |
Residue: | 158 |
Sequence: | MLVMKLFTCFLQVLAGLAVHSQGALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDE
YPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFS
QDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHP
|
|
|
BDBM50339203 |
---|
n/a |
---|
Name | BDBM50339203 |
Synonyms: | CHEMBL1689472 |
Type | Small organic molecule |
Emp. Form. | C96H143N23O26S3 |
Mol. Mass. | 2131.496 |
SMILES | CSCC[C@H](NC(=O)[C@@H](NC(=O)[C@H](CCCCNC(C)=O)NC(=O)[C@@H]1CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](Cc2ccccc2)NC(C)=O)C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCNC(=O)COCC(=O)Nc2ccc(CCC(=O)N3CCC3=O)cc2)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N2CCC[C@H]2C(=O)N[C@@H](Cc2cnc[nH]2)C(=O)N1)C(C)C)C(N)=O |r| |
Structure |
|