Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetbeta-Carbonic Anhydrase
LigandBDBM50339603
Substrate/Competitorn/a
Meas. Tech.ChEMBL_736724
Ki 960±n/a nM
Citation Davis RAHofmann AOsman AHall RAMühlschlegel FAVullo DInnocenti ASupuran CTPoulsen SA Natural product-based phenols as novel probes for mycobacterial and fungal carbonic anhydrases. J Med Chem 54:1682-92 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
beta-Carbonic Anhydrase
Name:beta-Carbonic Anhydrase
Synonyms:NCE103
Type:Enzyme
Mol. Mass.:31587.59
Organism:Candida albicans (Yeast)
Description:n/a
Residue:281
Sequence:
MGRENILKYQLEHDHESDLVTEKDQSLLLDNNNNLNGMNNTIKTHPVRVSSGNHNNFPFT
LSSESTLQDFLNNNKFFVDSIKHNHGNQIFDLNGQGQSPHTLWIGCSDSRAGDQCLATLP
GEIFVHRNIANIVNANDISSQGVIQFAIDVLKVKKIIVCGHTDCGGIWASLSKKKIGGVL
DLWLNPVRHIRAANLKLLEEYNQDPKLKAKKLAELNVISSVTALKRHPSASVALKKNEIE
VWGMLYDVATGYLSQVEIPQDEFEDLFHVHDEHDEEEYNPH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50339603
n/a
NameBDBM50339603
Synonyms:CHEMBL578932 | N-tert-butyl-2-(3-chloro-4-hydroxyphenyl)acetamide
TypeSmall organic molecule
Emp. Form.C12H16ClNO2
Mol. Mass.241.714
SMILESCC(C)(C)NC(=O)Cc1ccc(O)c(Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: