Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase 2 (Can2)
LigandBDBM50339596
Substrate/Competitorn/a
Meas. Tech.ChEMBL_736725
Ki 950±n/a nM
Citation Davis RAHofmann AOsman AHall RAMühlschlegel FAVullo DInnocenti ASupuran CTPoulsen SA Natural product-based phenols as novel probes for mycobacterial and fungal carbonic anhydrases. J Med Chem 54:1682-92 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase 2 (Can2)
Name:Carbonic Anhydrase 2 (Can2)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:26594.37
Organism:Cryptococcus neoformans var. grubii (Filobasidiella neoformans var. grubii)
Description:n/a
Residue:239
Sequence:
MPFHAEPLKPSDEIDMDLGHSVAAQKFKEIREVLEGNRYWARKVTSEEPEFMAEQVKGQA
PNFLWIGCADSRVPEVTIMARKPGDVFVQRNVANQFKPEDDSSQALLNYAIMNVGVTHVM
VVGHTGCGGCIAAFDQPLPTEENPGGTPLVRYLEPIIRLKHSLPEGSDVNDLIKENVKMA
VKNVVNSPTIQGAWEQARKGEFREVFVHGWLYDLSTGNIVDLNVTQGPHPFVDDRVPRA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50339596
n/a
NameBDBM50339596
Synonyms:4,4'-((1R,2S,3R,4S)-3,4-dimethylcyclobutane-1,2-diyl)bis(2-methoxyphenol) | 8beta,8'beta-dimethyl-7alpha,7'alpha-bis(3-methoxy-4-hydroxyphenyl)cyclobutane | CHEMBL517222 | endiandrin B
TypeSmall organic molecule
Emp. Form.C20H24O4
Mol. Mass.328.4022
SMILESCOc1cc(ccc1O)[C@H]1[C@H](C)[C@H](C)[C@H]1c1ccc(O)c(OC)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: