| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ribose-5-phosphate isomerase B |
|---|
| Ligand | BDBM50148767 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_744989 (CHEMBL1772004) |
|---|
| Ki | 400000±n/a nM |
|---|
| Citation |  Yep, A; Sorenson, RJ; Wilson, MR; Showalter, HD; Larsen, SD; Keller, PR; Woodard, RW Enediol mimics as inhibitors of the D-arabinose 5-phosphate isomerase (KdsD) from Francisella tularensis. Bioorg Med Chem Lett21:2679-82 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Ribose-5-phosphate isomerase B |
|---|
| Name: | Ribose-5-phosphate isomerase B |
|---|
| Synonyms: | Phosphoriboisomerase B | RPIB_MYCTU | rpiB |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 17277.83 |
|---|
| Organism: | Mycobacterium tuberculosis |
|---|
| Description: | ChEMBL_744989 |
|---|
| Residue: | 162 |
|---|
| Sequence: | MSGMRVYLGADHAGYELKQRIIEHLKQTGHEPIDCGALRYDADDDYPAFCIAAATRTVAD
PGSLGIVLGGSGNGEQIAANKVPGARCALAWSVQTAALAREHNNAQLIGIGGRMHTVAEA
LAIVDAFVTTPWSKAQRHQRRIDILAEYERTHEAPPVPGAPA
|
|
|
|---|
| BDBM50148767 |
|---|
| n/a |
|---|
| Name | BDBM50148767 |
|---|
| Synonyms: | 2,3-dihydroxy-4-(hydroxyamino)-4-oxobutyl dihydrogen phosphate | 4-PHOSPHO-D-ERYTHRONOHYDROXAMIC ACID | CHEMBL116018 | Phosphoric acid mono-((1R,3R)-2,3-dihydroxy-3-hydroxycarbamoyl-propyl) ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C4H10NO8P |
|---|
| Mol. Mass. | 231.0979 |
|---|
| SMILES | ONC(=O)[C@H](O)[C@H](O)COP(O)(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
