| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50026868 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_748646 (CHEMBL1780499) |
|---|
| Ki | 15000±n/a nM |
|---|
| Citation |  Rack, E; Fröhlich, R; Schepmann, D; Wünsch, B Design, synthesis and pharmacological evaluation of spirocyclics(1) receptor ligands with exocyclic amino moiety (increased distance 1). Bioorg Med Chem19:3141-51 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25307.17 |
|---|
| Organism: | Cavia porcellus (Guinea pig) |
|---|
| Description: | Q60492 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
|---|
| BDBM50026868 |
|---|
| n/a |
|---|
| Name | BDBM50026868 |
|---|
| Synonyms: | 2-(1H-indol-3-yl)-N,N-dimethylethanamine | 2-(3-indolyl)ethyldimethylamine | 3-(2-dimethylaminoethyl)indole | 3-[2-(dimethylamino)ethyl]indole | CHEMBL12420 | DMT | N,N-dimethyl-1H-indole-3-ethylamine | N,N-dimethyltryptamine | WO2023019367, Compound DMT |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H16N2 |
|---|
| Mol. Mass. | 188.2688 |
|---|
| SMILES | CN(C)CCc1c[nH]c2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
