Reaction Details |
| Report a problem with these data |
Target | Type 1 fimbrin D-mannose specific adhesin |
---|
Ligand | BDBM50347452 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_755504 (CHEMBL1805065) |
---|
IC50 | 16±n/a nM |
---|
Citation | Klein, T; Abgottspon, D; Wittwer, M; Rabbani, S; Herold, J; Jiang, X; Kleeb, S; Lüthi, C; Scharenberg, M; Bezençon, J; Gubler, E; Pang, L; Smiesko, M; Cutting, B; Schwardt, O; Ernst, B FimH antagonists for the oral treatment of urinary tract infections: from design and synthesis to in vitro and in vivo evaluation. J Med Chem53:8627-41 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Type 1 fimbrin D-mannose specific adhesin |
---|
Name: | Type 1 fimbrin D-mannose specific adhesin |
Synonyms: | Adhesin protein fimH | FIMH_ECOLI | fimH |
Type: | PROTEIN |
Mol. Mass.: | 31474.61 |
Organism: | Escherichia coli (strain K12) |
Description: | ChEMBL_1298296 |
Residue: | 300 |
Sequence: | MKRVITLFAVLLMGWSVNAWSFACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLS
TQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRT
DKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTG
GCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQ
GVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
|
|
|
BDBM50347452 |
---|
n/a |
---|
Name | BDBM50347452 |
Synonyms: | CHEMBL1802190 |
Type | Small organic molecule |
Emp. Form. | C20H20Cl2O8 |
Mol. Mass. | 459.274 |
SMILES | COC(=O)c1ccc(cc1)-c1cc(Cl)c(O[C@H]2O[C@H](CO)[C@@H](O)[C@H](O)[C@@H]2O)c(Cl)c1 |r| |
Structure |
|