Reaction Details |
| Report a problem with these data |
Target | Retinol-binding protein 4 |
---|
Ligand | BDBM50347599 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_756077 (CHEMBL1804187) |
---|
EC50 | 154±n/a nM |
---|
Citation | Campos-Sandoval, JA; Redondo, C; Kinsella, GK; Pal, A; Jones, G; Eyre, GS; Hirst, SC; Findlay, JB Fenretinide derivatives act as disrupters of interactions of serum retinol binding protein (sRBP) with transthyretin and the sRBP receptor. J Med Chem54:4378-87 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Retinol-binding protein 4 |
---|
Name: | Retinol-binding protein 4 |
Synonyms: | PRBP | Plasma retinol-binding protein | RBP | RBP4 | RET4_HUMAN | Retinol-binding protein 4 | Retinol-binding protein 4 (RBP4) | spa binding assay for rbp4 |
Type: | Protein |
Mol. Mass.: | 23008.75 |
Organism: | Homo sapiens (Human) |
Description: | P02753 |
Residue: | 201 |
Sequence: | MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIV
AEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGND
DHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLA
RQYRLIVHNGYCDGRSERNLL
|
|
|
BDBM50347599 |
---|
n/a |
---|
Name | BDBM50347599 |
Synonyms: | CHEMBL1802454 |
Type | Small organic molecule |
Emp. Form. | C24H35NO2 |
Mol. Mass. | 369.5402 |
SMILES | C\C(\C=C\C1=C(C)CCCC1(C)C)=C/C=C/C(/C)=C/C(=O)N1CCOCC1 |c:4| |
Structure |
|