Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual specificity protein kinase CLK1
LigandBDBM50347747
Substrate/Competitorn/a
Meas. Tech.ChEMBL_756288
IC50 830±n/a nM
Citation Debdab MCarreaux FRenault SSoundararajan MFedorov OFilippakopoulos PLozach OBabault LTahtouh TBaratte BOgawa YHagiwara MEisenreich ARauch UKnapp SMeijer LBazureau JP Leucettines, a class of potent inhibitors of cdc2-like kinases and dual specificity, tyrosine phosphorylation regulated kinases derived from the marine sponge leucettamine B: modulation of alternative pre-RNA splicing. J Med Chem 54:4172-86 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dual specificity protein kinase CLK1
Name:Dual specificity protein kinase CLK1
Synonyms:CDC-like kinase 1 | Protein kinase STY
Type:PROTEIN
Mol. Mass.:57124.52
Organism:Mus musculus
Description:ChEMBL_1502245
Residue:483
Sequence:
MRHSKRTYCPDWDERDWDYGTWRSSSSHKRKKRSHSSAREQKRCRYDHSKTTDSYYLESR
SINEKAYHSRRYVDEYRNDYMGYEPGHPYGEPGSRYQMHSSKSSGRSGRSSYKSKHRSRH
HTSQHHSHGKSHRRKRSRSVEDDEEGHLICQSGDVLSARYEIVDTLGEGAFGKVVECIDH
KVGGRRVAVKIVKNVDRYCEAAQSEIQVLEHLNTTDPHSTFRCVQMLEWFEHRGHICIVF
ELLGLSTYDFIKENSFLPFRMDHIRKMAYQICKSVNFLHSNKLTHTDLKPENILFVKSDY
TEAYNPKMKRDERTIVNPDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPCD
VWSIGCILIEYYLGFTVFPTHDSREHLAMMERILGPLPKHMIQKTRKRRYFHHDRLDWDE
HSSAGRYVSRRCKPLKEFMLSQDAEHELLFDLIGKMLEYDPAKRITLKEALKHPFFYPLK
KHT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50347747
n/a
NameBDBM50347747
Synonyms:CHEMBL1802355
TypeSmall organic molecule
Emp. Form.C18H15N3O4
Mol. Mass.337.3294
SMILESCOc1ccc(NC2=NC(=Cc3ccc4OCOc4c3)C(=O)N2)cc1 |w:10.10,t:7|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: