Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual specificity protein kinase CLK3
LigandBDBM50347746
Substrate/Competitorn/a
Meas. Tech.ChEMBL_756289
IC50 520±n/a nM
Citation Debdab MCarreaux FRenault SSoundararajan MFedorov OFilippakopoulos PLozach OBabault LTahtouh TBaratte BOgawa YHagiwara MEisenreich ARauch UKnapp SMeijer LBazureau JP Leucettines, a class of potent inhibitors of cdc2-like kinases and dual specificity, tyrosine phosphorylation regulated kinases derived from the marine sponge leucettamine B: modulation of alternative pre-RNA splicing. J Med Chem 54:4172-86 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dual specificity protein kinase CLK3
Name:Dual specificity protein kinase CLK3
Synonyms:CDC-like kinase 3
Type:PROTEIN
Mol. Mass.:73855.32
Organism:Mus musculus
Description:ChEMBL_1502247
Residue:638
Sequence:
MPVLSARRKRLASTAGPRRGSGPSLAVRWVPPLGPEPSSDRGRAPMRPRGPTCSTTRRGA
GRGPRLLPGPPGRDLHRCRPDPGGAGQSPRVCEFGARAVRPLGRVEPGPPTAASREGAVL
PRAEARAGSGRGARSGEWGLAAAGAWETMHHCKRYRSPEPDPYLSYRWKRRRSYSREHEG
RLRYPSRREPPPRRSRSRSHDRIPYQRRYREHRDSDTYRCEERSPSFGEDCYGSSRSRHR
RRSRERAPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSVEDDKEGHLVCRIGDWL
QERYEIVGNLGEGTFGKVVECLDHARGKSQVALKIIRNVGKYREAARLEINVLKKIKEKD
KENKFLCVLMSDWFNFHGHMCIAFELLGKNTFEFLKENNFQPYPLPHVRHMAYQLCHALR
FLHENQLTHTDLKPENILFVNSEFETLYNEHKSCEEKSVKNTSIRVADFGSATFDHEHHT
TIVATRHYRPPEVILELGWAQPCDVWSIGCILFEYYRGFTLFQTHENREHLVMMEKILGP
IPSHMIHRTRKQKYFYKGGLVWDENSSDGRYVKENCKPLKSYMLQDSLEHVQLFDLMRRM
LEFDPAQRITLAEALLHPFFAGLTPEERSFHSSRNPSR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50347746
n/a
NameBDBM50347746
Synonyms:CHEMBL1803085
TypeSmall organic molecule
Emp. Form.C17H13N3O4
Mol. Mass.323.3028
SMILESOc1ccc(NC2=NC(=Cc3ccc4OCOc4c3)C(=O)N2)cc1 |w:9.9,t:6|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: