Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInterferon-induced, double-stranded RNA-activated protein kinase
LigandBDBM6877
Substrate/Competitorn/a
Meas. Tech.ChEMBL_756675
IC50 8000±n/a nM
Citation Bryk RWu KRaimundo BCBoardman PEChao PConn GLAnderson ECole JLDuffy NPNathan CGriffin JH Identification of new inhibitors of protein kinase R guided by statistical modeling. Bioorg Med Chem Lett 21:4108-14 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Interferon-induced, double-stranded RNA-activated protein kinase
Name:Interferon-induced, double-stranded RNA-activated protein kinase
Synonyms:EIF2AK2 | Eukaryotic translation initiation factor 2-alpha kinase 2 | Interferon-inducible RNA-dependent protein kinase | P1/eIF-2A protein kinase | PKR | PRKR | Protein kinase R | Protein kinase RNA-activated | Tyrosine-protein kinase EIF2AK2 | eIF-2A protein kinase 2 | p68 kinase
Type:PROTEIN
Mol. Mass.:62104.61
Organism:Homo sapiens (Human)
Description:ChEMBL_1467743
Residue:551
Sequence:
MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSK
KEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQ
CASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETSVKSDYLSSG
SFATTCESQSNSLVTSTLASESSSEGDFSADTSEINSNSDSLNSSSLLMNGLRNNQRKAK
RSLAPRFDLPDMKETKYTVDKRFGMDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKY
NNEKAEREVKALAKLDHVNIVHYNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTK
CLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNI
FLVDTKQVKIGDFGLVTSLKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAE
LLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWK
KSPEKNERHTC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM6877
n/a
NameBDBM6877
Synonyms:1-Acyl-1H-[1,2,4]triazole-3,5-diamine Analogue 3m | 5-Amino-3-[[4-(aminosulfonyl)phenyl]amino]-N-(2,6-difluorophenyl)-1H-1,2,4-triazole-1-carboamide | 5-amino-N-(2,6-difluorophenyl)-3-[(4-sulfamoylphenyl)amino]-1H-1,2,4-triazole-1-carboxamide
TypeSmall organic molecule
Emp. Form.C15H13F2N7O3S
Mol. Mass.409.371
SMILESNc1nc(Nc2ccc(cc2)S(N)(=O)=O)nn1C(=O)Nc1c(F)cccc1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: