Reaction Details |
| Report a problem with these data |
Target | Protein-S-isoprenylcysteine O-methyltransferase |
---|
Ligand | BDBM50348068 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_757250 (CHEMBL1803626) |
---|
IC50 | 3.8±n/a nM |
---|
Citation | Judd, WR; Slattum, PM; Hoang, KC; Bhoite, L; Valppu, L; Alberts, G; Brown, B; Roth, B; Ostanin, K; Huang, L; Wettstein, D; Richards, B; Willardsen, JA Discovery and SAR of methylated tetrahydropyranyl derivatives as inhibitors of isoprenylcysteine carboxyl methyltransferase (ICMT). J Med Chem54:5031-47 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Protein-S-isoprenylcysteine O-methyltransferase |
---|
Name: | Protein-S-isoprenylcysteine O-methyltransferase |
Synonyms: | ICMT | ICMT_HUMAN | Isoprenylcysteine carboxyl methyltransferase | PCCMT |
Type: | PROTEIN |
Mol. Mass.: | 31943.26 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_956034 |
Residue: | 284 |
Sequence: | MAGCAARAPPGSEARLSLATFLLGASVLALPLLTRAGLQGRTGLALYVAGLNALLLLLYR
PPRYQIAIRACFLGFVFGCGTLLSFSQSSWSHFGWYMCSLSLFHYSEYLVTAVNNPKSLS
LDSFLLNHSLEYTVAALSSWLEFTLENIFWPELKQITWLSVTGLLMVVFGECLRKAAMFT
AGSNFNHVVQNEKSDTHTLVTSGVYAWFRHPSYVGWFYWSIGTQVMLCNPICGVSYALTV
WRFFRDRTEEEEISLIHFFGEEYLEYKKRVPTGLPFIKGVKVDL
|
|
|
BDBM50348068 |
---|
n/a |
---|
Name | BDBM50348068 |
Synonyms: | CHEMBL1800516 |
Type | Small organic molecule |
Emp. Form. | C19H24ClNOS |
Mol. Mass. | 349.918 |
SMILES | CC1(C)CC(CCNc2cccc(Cl)c2)(CCO1)c1cccs1 |
Structure |
|