Reaction Details |
| Report a problem with these data |
Target | Peptide deformylase, mitochondrial |
---|
Ligand | BDBM50349083 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_759151 (CHEMBL1811208) |
---|
IC50 | 15000±n/a nM |
---|
Citation | Antczak, C; Shum, D; Bassit, B; Frattini, MG; Li, Y; de Stanchina, E; Scheinberg, DA; Djaballah, H Identification of benzofuran-4,5-diones as novel and selective non-hydroxamic acid, non-peptidomimetic based inhibitors of human peptide deformylase. Bioorg Med Chem Lett21:4528-32 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptide deformylase, mitochondrial |
---|
Name: | Peptide deformylase, mitochondrial |
Synonyms: | DEFM_HUMAN | PDF | PDF1A | Peptide deformylase mitochondrial | Peptide deformylase, mitochondrial | Polypeptide deformylase |
Type: | PROTEIN |
Mol. Mass.: | 27023.25 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_154318 |
Residue: | 243 |
Sequence: | MARLWGALSLWPLWAAVPWGGAAAVGVRACSSTAAPDGVEGPALRRSYWRHLRRLVLGPP
EPPFSHVCQVGDPVLRGVAAPVERAQLGGPELQRLTQRLVQVMRRRRCVGLSAPQLGVPR
QVLALELPEALCRECPPRQRALRQMEPFPLRVFVNPSLRVLDSRLVTFPEGCESVAGFLA
CVPRFQAVQISGLDPNGEQVVWQASGWAARIIQHEMDHLQGCLFIDKMDSRTFTNVYWMK
VND
|
|
|
BDBM50349083 |
---|
n/a |
---|
Name | BDBM50349083 |
Synonyms: | CHEMBL1807950 |
Type | Small organic molecule |
Emp. Form. | C16H8Cl2O5 |
Mol. Mass. | 351.138 |
SMILES | COc1ccc(cc1)C(=O)c1coc2c1C(=O)C(=O)C(Cl)=C2Cl |c:22| |
Structure |
|