| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptide deformylase, mitochondrial |
|---|
| Ligand | BDBM50349085 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_759151 (CHEMBL1811208) |
|---|
| IC50 | 25000±n/a nM |
|---|
| Citation |  Antczak, C; Shum, D; Bassit, B; Frattini, MG; Li, Y; de Stanchina, E; Scheinberg, DA; Djaballah, H Identification of benzofuran-4,5-diones as novel and selective non-hydroxamic acid, non-peptidomimetic based inhibitors of human peptide deformylase. Bioorg Med Chem Lett21:4528-32 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptide deformylase, mitochondrial |
|---|
| Name: | Peptide deformylase, mitochondrial |
|---|
| Synonyms: | DEFM_HUMAN | PDF | PDF1A | Peptide deformylase mitochondrial | Peptide deformylase, mitochondrial | Polypeptide deformylase |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 27023.25 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_154318 |
|---|
| Residue: | 243 |
|---|
| Sequence: | MARLWGALSLWPLWAAVPWGGAAAVGVRACSSTAAPDGVEGPALRRSYWRHLRRLVLGPP
EPPFSHVCQVGDPVLRGVAAPVERAQLGGPELQRLTQRLVQVMRRRRCVGLSAPQLGVPR
QVLALELPEALCRECPPRQRALRQMEPFPLRVFVNPSLRVLDSRLVTFPEGCESVAGFLA
CVPRFQAVQISGLDPNGEQVVWQASGWAARIIQHEMDHLQGCLFIDKMDSRTFTNVYWMK
VND
|
|
|
|---|
| BDBM50349085 |
|---|
| n/a |
|---|
| Name | BDBM50349085 |
|---|
| Synonyms: | CHEMBL1808000 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H12Cl2O7 |
|---|
| Mol. Mass. | 411.19 |
|---|
| SMILES | COc1cc(cc(OC)c1OC)C(=O)c1coc2c1C(=O)C(=O)C(Cl)=C2Cl |c:26| |
|---|
| Structure | 
|
|---|
Search and Browse
