Reaction Details |
| Report a problem with these data |
Target | Peptide deformylase |
---|
Ligand | BDBM50349080 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_759152 (CHEMBL1811209) |
---|
IC50 | >100000±n/a nM |
---|
Citation | Antczak, C; Shum, D; Bassit, B; Frattini, MG; Li, Y; de Stanchina, E; Scheinberg, DA; Djaballah, H Identification of benzofuran-4,5-diones as novel and selective non-hydroxamic acid, non-peptidomimetic based inhibitors of human peptide deformylase. Bioorg Med Chem Lett21:4528-32 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptide deformylase |
---|
Name: | Peptide deformylase |
Synonyms: | 3.5.1.88 | BON69_24600 | BON94_18585 | D9G11_24945 | D9G11_25760 | D9J60_20755 | FORC82_p394 | PDF | Polypeptide deformylase | SAMEA3472033_04733 | def | def_2 |
Type: | n/a |
Mol. Mass.: | 16901.39 |
Organism: | Escherichia coli |
Description: | n/a |
Residue: | 150 |
Sequence: | MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIV
IDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFE
LEADGLLAICIGLRLGNGKYCTLRLFFNQV
|
|
|
BDBM50349080 |
---|
n/a |
---|
Name | BDBM50349080 |
Synonyms: | CHEMBL1807947 |
Type | Small organic molecule |
Emp. Form. | C16H9ClO5 |
Mol. Mass. | 316.693 |
SMILES | COc1ccc(cc1)C(=O)c1coc2c1C(=O)C(=O)C=C2Cl |c:21| |
Structure |
|