Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50351180 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_764179 (CHEMBL1821390) |
---|
Ki | 0.48±n/a nM |
---|
Citation | Li, X; Hilgers, M; Cunningham, M; Chen, Z; Trzoss, M; Zhang, J; Kohnen, L; Lam, T; Creighton, C; G C, K; Nelson, K; Kwan, B; Stidham, M; Brown-Driver, V; Shaw, KJ; Finn, J Structure-based design of new DHFR-based antibacterial agents: 7-aryl-2,4-diaminoquinazolines. Bioorg Med Chem Lett21:5171-6 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_STAAU | Dihydrofolate Reductase (DHFR) | Dihydrofolate reductase | Dihydrofolate reductase (DfrB) | Tetrahydrofolate dehydrogenase | folA |
Type: | Enzyme |
Mol. Mass.: | 18249.71 |
Organism: | Staphylococcus aureus |
Description: | n/a |
Residue: | 159 |
Sequence: | MTLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRN
VVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRG
DTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRKK
|
|
|
BDBM50351180 |
---|
n/a |
---|
Name | BDBM50351180 |
Synonyms: | CHEMBL1818120 | US8835445, 7 |
Type | Small organic molecule |
Emp. Form. | C17H16N4O |
Mol. Mass. | 292.3351 |
SMILES | CC(=O)c1cccc(c1)-c1cc2nc(N)nc(N)c2cc1C |
Structure |
|