Reaction Details |
| Report a problem with these data |
Target | Thymidylate synthase ThyA |
---|
Ligand | BDBM50351761 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_764952 (CHEMBL1827109) |
---|
IC50 | >50000±n/a nM |
---|
Citation | Kögler, M; Vanderhoydonck, B; De Jonghe, S; Rozenski, J; Van Belle, K; Herman, J; Louat, T; Parchina, A; Sibley, C; Lescrinier, E; Herdewijn, P Synthesis and evaluation of 5-substituted 2'-deoxyuridine monophosphate analogues as inhibitors of flavin-dependent thymidylate synthase in Mycobacterium tuberculosis. J Med Chem54:4847-62 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Thymidylate synthase ThyA |
---|
Name: | Thymidylate synthase ThyA |
Synonyms: | TS | TSase | TYSY_MYCTU | Thymidylate synthase | thyA |
Type: | PROTEIN |
Mol. Mass.: | 29848.00 |
Organism: | Mycobacterium tuberculosis |
Description: | ChEMBL_764952 |
Residue: | 263 |
Sequence: | MTPYEDLLRFVLETGTPKSDRTGTGTRSLFGQQMRYDLSAGFPLLTTKKVHFKSVAYELL
WFLRGDSNIGWLHEHGVTIWDEWASDTGELGPIYGVQWRSWPAPSGEHIDQISAALDLLR
TDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVADGRLSCQLYQRSADLFLGVPFNIAS
YALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADRDSIFE
YTYEDIVVKNYDPHPAIKAPVAV
|
|
|
BDBM50351761 |
---|
n/a |
---|
Name | BDBM50351761 |
Synonyms: | CHEMBL1823501 |
Type | Small organic molecule |
Emp. Form. | C18H24N3O9P |
Mol. Mass. | 457.3727 |
SMILES | CCCCCC(=O)NCC#Cc1cn([C@H]2C[C@H](O)[C@@H](COP([O-])([O-])=O)O2)c(=O)[nH]c1=O |r| |
Structure |
|