Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNociceptin receptor
LigandBDBM50354570
Substrate/Competitorn/a
Meas. Tech.ChEMBL_771030
Ki 8.5±n/a nM
Citation Cami-Kobeci GPolgar WEKhroyan TVToll LHusbands SM Structural determinants of opioid and NOP receptor activity in derivatives of buprenorphine. J Med Chem 54:6531-7 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Nociceptin receptor
Name:Nociceptin receptor
Synonyms:KOR-3 | Kappa-type 3 opioid receptor | Mu-type opioid receptor (Mu) | NOP | Nociceptin Receptor (ORL1 Receptor) | Nociceptin receptor (NOP) | Nociceptin receptor (ORL-1) | Nociceptin receptor (ORL1) | Nociceptin/Orphanin FQ, NOP receptor | OPIATE ORL-1 | OPRL1 protein | ORL1 receptor | Opioid receptor like-1 | Orphanin FQ receptor | Orphanin FQ receptor (ORL1) | P41146
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:40702.87
Organism:Homo sapiens (Human)
Description:P41146
Residue:370
Sequence:
MEPLFPAPFWEVIYGSHLQGNLSLLSPNHSLLPPHLLLNASHGAFLPLGLKVTIVGLYLA
VCVGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGN
ALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASV
VGVPVAIMGSAQVEDEEIECLVEIPTPQDYWGPVFAICIFLFSFIVPVLVISVCYSLMIR
RLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLAQGLGVQPSSETAVAI
LRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALRRDVQVSDRVRSIAKDVALAC
KTSETVPRPA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50354570
n/a
NameBDBM50354570
Synonyms:CHEMBL1834409
TypeSmall organic molecule
Emp. Form.C30H43NO4
Mol. Mass.481.6667
SMILESCCC(C)(C)[C@](C)(O)[C@H]1C[C@]23CC[C@]1(OC)[C@@H]1Oc4c5c(C[C@H]2N(CC2CC2)CC[C@@]315)ccc4O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: