| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Adenosine receptor A3 |
|---|
| Ligand | BDBM50355171 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_772802 (CHEMBL1837541) |
|---|
| Ki | 0.2±n/a nM |
|---|
| Citation |  Cheong, SL; Dolzhenko, AV; Paoletta, S; Lee, EP; Kachler, S; Federico, S; Klotz, KN; Dolzhenko, AV; Spalluto, G; Moro, S; Pastorin, G Does the combination of optimal substitutions at the C²-, N¿?¿- and N¿?¿-positions of the pyrazolo-triazolo-pyrimidine scaffold guarantee selective modulation of the human A3 adenosine receptors? Bioorg Med Chem19:6120-34 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Adenosine receptor A3 |
|---|
| Name: | Adenosine receptor A3 |
|---|
| Synonyms: | A3 adenosine receptor (hA3) | AA3R_HUMAN | ADORA3 | Adenosine A3 receptor (A3AR) |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 36197.32 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P0DMS8 |
|---|
| Residue: | 318 |
|---|
| Sequence: | MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
|
|
|
|---|
| BDBM50355171 |
|---|
| n/a |
|---|
| Name | BDBM50355171 |
|---|
| Synonyms: | CHEMBL1834704 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H20N8O3 |
|---|
| Mol. Mass. | 480.4781 |
|---|
| SMILES | COc1ccc(NC(=O)Nc2nc3nn(C)cc3c3nc(nn23)-c2ccc(cc2)-c2ccco2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
