| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Interleukin-1 beta |
|---|
| Ligand | BDBM50355791 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_776544 (CHEMBL1913641) |
|---|
| IC50 | 34300±n/a nM |
|---|
| Citation |  Stierle, DB; Stierle, AA; Patacini, B; McIntyre, K; Girtsman, T; Bolstad, E Berkeleyones and related meroterpenes from a deep water acid mine waste fungus that inhibit the production of interleukin 1-ß from induced inflammasomes. J Nat Prod74:2273-7 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Interleukin-1 beta |
|---|
| Name: | Interleukin-1 beta |
|---|
| Synonyms: | IL1B | IL1B_HUMAN | IL1F2 | Interleukin 1-beta | Interleukin-1 beta | hIL-1beta |
|---|
| Type: | Cytokine |
|---|
| Mol. Mass.: | 30734.47 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P01584 |
|---|
| Residue: | 269 |
|---|
| Sequence: | MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKG
FRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVR
SLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKE
KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST
SQAENMPVFLGGTKGGQDITDFTMQFVSS
|
|
|
|---|
| BDBM50355791 |
|---|
| n/a |
|---|
| Name | BDBM50355791 |
|---|
| Synonyms: | CHEMBL1911629 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H36O7 |
|---|
| Mol. Mass. | 460.5598 |
|---|
| SMILES | COC(=O)[C@@]12C(=C)[C@@](C)(C[C@H]3[C@]4(C)CCC(=O)OC(C)(C)[C@@H]4CC[C@]13C)C(=O)[C@](C)(O)C2=O |r,THB:6:5:10.24.9:26.31.28| |
|---|
| Structure | 
|
|---|
Search and Browse
