Reaction Details |
| Report a problem with these data |
Target | Cannabinoid receptor 2 |
---|
Ligand | BDBM50356013 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_775351 (CHEMBL1912836) |
---|
Kd | >10000±n/a nM |
---|
Citation | Yang, Y; Miller, KJ; Zhu, Y; Hong, Y; Tian, Y; Murugesan, N; Gu, Z; O'Tanyi, E; Keim, WJ; Rohrbach, KW; Johnghar, S; Behnia, K; Pelleymounter, MA; Carlson, KE; Ewing, WR Characterization of a novel and selective CB1 antagonist as a radioligand for receptor occupancy studies. Bioorg Med Chem Lett21:6856-60 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cannabinoid receptor 2 |
---|
Name: | Cannabinoid receptor 2 |
Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CNR2_HUMAN | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 39690.94 |
Organism: | Homo sapiens (Human) |
Description: | P34972 |
Residue: | 360 |
Sequence: | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
|
|
|
BDBM50356013 |
---|
n/a |
---|
Name | BDBM50356013 |
Synonyms: | CHEMBL1911374 | CHEMBL1911375 |
Type | Small organic molecule |
Emp. Form. | C23H14ClF3N6O |
Mol. Mass. | 482.845 |
SMILES | FC(F)(F)c1ccc(Cn2nc3c(-c4ccncc4)c(cnn3c2=O)-c2ccc(Cl)cc2)cn1 |
Structure |
|