| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bcl2-associated agonist of cell death |
|---|
| Ligand | BDBM50357610 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_788226 (CHEMBL1919428) |
|---|
| EC50 | 1020±n/a nM |
|---|
| Citation |  Pierre, F; Stefan, E; Nédellec, AS; Chevrel, MC; Regan, CF; Siddiqui-Jain, A; Macalino, D; Streiner, N; Drygin, D; Haddach, M; O'Brien, SE; Anderes, K; Ryckman, DM 7-(4H-1,2,4-Triazol-3-yl)benzo[c][2,6]naphthyridines: a novel class of Pim kinase inhibitors with potent cell antiproliferative activity. Bioorg Med Chem Lett21:6687-92 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Bcl2-associated agonist of cell death |
|---|
| Name: | Bcl2-associated agonist of cell death |
|---|
| Synonyms: | BAD | BAD_HUMAN | BBC6 | BCL2L8 | Bcl-2-binding component 6 | Bcl-2-like protein 8 | Bcl-XL/Bcl-2-associated death promoter | Bcl2 antagonist of cell death | Bcl2-L-8 | Bcl2-antagonist of cell death (BAD) |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 18393.69 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_478760 |
|---|
| Residue: | 168 |
|---|
| Sequence: | MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH
HGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDE
FVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
|
|
|
|---|
| BDBM50357610 |
|---|
| n/a |
|---|
| Name | BDBM50357610 |
|---|
| Synonyms: | CHEMBL1915644 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H15ClN4O |
|---|
| Mol. Mass. | 362.812 |
|---|
| SMILES | CNC(=O)c1cccc2c1nc(Nc1ccccc1Cl)c1ccncc21 |
|---|
| Structure | 
|
|---|
Search and Browse
