| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Urokinase plasminogen activator surface receptor |
|---|
| Ligand | BDBM50357760 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_786179 (CHEMBL1920013) |
|---|
| Ki | 20000±n/a nM |
|---|
| Citation |  Wang, F; Li, J; Sinn, AL; Knabe, WE; Khanna, M; Jo, I; Silver, JM; Oh, K; Li, L; Sandusky, GE; Sledge, GW; Nakshatri, H; Jones, DR; Pollok, KE; Meroueh, SO Virtual screening targeting the urokinase receptor, biochemical and cell-based studies, synthesis, pharmacokinetic characterization, and effect on breast tumor metastasis. J Med Chem54:7193-205 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Urokinase plasminogen activator surface receptor |
|---|
| Name: | Urokinase plasminogen activator surface receptor |
|---|
| Synonyms: | CD_antigen=CD87 | MO3 | Monocyte activation antigen Mo3 | PLAUR | U-PAR | UPAR | UPAR_HUMAN | Urokinase plasminogen activator surface receptor | Urokinase receptor (uPAR) | Urokinase-type plasminogen activator/surface receptor |
|---|
| Type: | Receptor |
|---|
| Mol. Mass.: | 36979.14 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q03405 |
|---|
| Residue: | 335 |
|---|
| Sequence: | MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEEL
ELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISC
GSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNG
FHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGP
MNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDV
QYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT
|
|
|
|---|
| BDBM50357760 |
|---|
| n/a |
|---|
| Name | BDBM50357760 |
|---|
| Synonyms: | CHEMBL1916397 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H30N2O2 |
|---|
| Mol. Mass. | 402.5286 |
|---|
| SMILES | CN(C)c1ccc(CNCCC(Cc2ccccc2)c2ccc3OCOc3c2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
