Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCAI-1 autoinducer sensor kinase/phosphatase CqsS
LigandBDBM50358425
Substrate/Competitorn/a
Meas. Tech.ChEMBL_789528
IC50>500000±n/a nM
Citation Bolitho MEPerez LJKoch MJNg WLBassler BLSemmelhack MF Small molecule probes of the receptor binding site in the Vibrio cholerae CAI-1 quorum sensing circuit. Bioorg Med Chem 19:6906-18 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
CAI-1 autoinducer sensor kinase/phosphatase CqsS
Name:CAI-1 autoinducer sensor kinase/phosphatase CqsS
Synonyms:Cholerae quorum-sensing sensor
Type:PROTEIN
Mol. Mass.:78371.16
Organism:Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Description:ChEMBL_789528
Residue:686
Sequence:
MIVSMDVIKRVYQYAEPNLSLVGWMGMLGFPAYYFIWEYWFPQSYENLGLRCAAAVLFGG
LVFRDSMPKKWQRYMPGYFLFTIGFCLPFFFAFMMLMNDWSTIWAMSFMASIFLHILLVH
DTRVMALQALFSVLVAYLAVYGLTDFHPTTLIEWQYIPIFLFTYVFGNLCFFRNQISHET
KVSIAKTFGAGIAHEMRNPLSALKTSIDVVRTMIPKPQTAAHTDYSLDAQELDLLHQILN
EADDVIYSGNNAIDLLLTSIDENRVSPASFKKHSVVDVIEKAVKTFPYKNAADQHSVELE
VHQPFDFFGSDTLLTYALFNLLKNAFYYQKEHFSVCISIEQTSEHNLIRVRDNGVGIAPE
MLEDIFRDFYTFGKNGSYGLGLPFCRKVMSAFGGTIRCASQQGQWTEFVLSFPRYDSDTV
NEIKTELLKTKSLIYIGSNQAIVRELNQLAVEDEFGFTAISAQQAVRRQDYEFEFDLILL
DLDDATAQGELLPKLEGTLSFAEGCIGYVYDPGKTYAVNINRYLRIQPISIHSILRKPRK
IIERLLFEQESLSMNRNVIPLQKSRHERRILVVDDNQSIRTFTAILLEQQGYEVVQANDG
SEVLKHMESQNIDLVLMDIEMPNVGGLEATRLIRNSEHEYKNIPIIGYTGDNSPKTLALV
QTSGMNDFIVKPADRDVLLNKVAAWV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50358425
n/a
NameBDBM50358425
Synonyms:CHEMBL1922892
TypeSmall organic molecule
Emp. Form.C17H25BrO2
Mol. Mass.341.283
SMILESCCCCCCCCCC(=O)C(O)c1ccccc1Br
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: