| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E synthase |
|---|
| Ligand | BDBM50060279 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_794980 (CHEMBL1936307) |
|---|
| IC50 | 800±n/a nM |
|---|
| Citation |  Wiegard, A; Hanekamp, W; Griessbach, K; Fabian, J; Lehr, M Pyrrole alkanoic acid derivatives as nuisance inhibitors of microsomal prostaglandin E2 synthase-1. Eur J Med Chem48:153-63 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E synthase |
|---|
| Name: | Prostaglandin E synthase |
|---|
| Synonyms: | MGST1L1 | MPGES1 | PGES | PIG12 | PTGES | PTGES_HUMAN | Prostaglandin E synthase (PGES-1) | Prostaglandin E synthase 1 (mPGES-1) | Prostaglandin E synthase-1 (PGES-1) | Prostaglandin E synthase/G/H synthase 2 | Prostaglandin E2 synthase-1 ( mPGES-1) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 17112.22 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 152 |
|---|
| Sequence: | MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
|
|
|
|---|
| BDBM50060279 |
|---|
| n/a |
|---|
| Name | BDBM50060279 |
|---|
| Synonyms: | 3-(4-Dodecanoyl-1,3,5-trimethyl-1H-pyrrol-2-yl)-propionic acid | CHEMBL442012 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H37NO3 |
|---|
| Mol. Mass. | 363.5341 |
|---|
| SMILES | CCCCCCCCCCCC(=O)c1c(C)c(CCC(O)=O)n(C)c1C |
|---|
| Structure | 
|
|---|
Search and Browse
