Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50334158 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_799943 (CHEMBL1941649) |
---|
Ki | 0.590000±n/a nM |
---|
Citation | Maisonial, A; Grosse Maestrup, E; Wiese, C; Hiller, A; Schepmann, D; Fischer, S; Deuther-Conrad, W; Steinbach, J; Brust, P; Wünsch, B Synthesis, radiofluorination and pharmacological evaluation of a fluoromethyl spirocyclic PET tracer for centrals1 receptors and comparison with fluoroalkyl homologs. Bioorg Med Chem20:257-69 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
Type: | Protein |
Mol. Mass.: | 25307.17 |
Organism: | Cavia porcellus (Guinea pig) |
Description: | Q60492 |
Residue: | 223 |
Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
BDBM50334158 |
---|
n/a |
---|
Name | BDBM50334158 |
Synonyms: | 1'-benzyl-3-(2-fluoroethyl)-3H-spiro[[2]benzofuran-1,4'-piperidine | CHEMBL1645202 | CHEMBL2314421 |
Type | Small organic molecule |
Emp. Form. | C21H24FNO |
Mol. Mass. | 325.4198 |
SMILES | FCCC1OC2(CCN(Cc3ccccc3)CC2)c2ccccc12 |
Structure |
|