| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Aldo-keto reductase family 1 member B1 |
|---|
| Ligand | BDBM50241243 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_797273 (CHEMBL1942674) |
|---|
| IC50 | 60500±n/a nM |
|---|
| Citation |  Naeem, S; Hylands, P; Barlow, D Construction of an Indonesian herbal constituents database and its use in Random Forest modelling in a search for inhibitors of aldose reductase. Bioorg Med Chem20:1251-8 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Aldo-keto reductase family 1 member B1 |
|---|
| Name: | Aldo-keto reductase family 1 member B1 |
|---|
| Synonyms: | AKR1B1 | ALDR1 | ALDR_HUMAN | ALR2 | AR | Aldo-keto reductase family 1 member B1 (AKR1B1) | Aldose Reductase (ALR2) | Aldose reductase | Aldose reductase (AR) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 35855.50 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P15121. 4LAU; 2IKI; 4LB4; 2FZD; 2FZ8; 1US0 |
|---|
| Residue: | 316 |
|---|
| Sequence: | MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQ
EKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGK
EFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKP
AVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAK
HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCA
LLSCTSHKDYPFHEEF
|
|
|
|---|
| BDBM50241243 |
|---|
| n/a |
|---|
| Name | BDBM50241243 |
|---|
| Synonyms: | 3,4',5,7-Tetrahydroxyflavone-3-glucoside | 3-(beta-D-glucopyranosyloxy)-5,7-dihydroxy-2-(4-hydroxyphenyl)-4H-chromen-4-one | 4H-1-Benzopyran-4-one, 3-(beta-D-glucopyranosyloxy)-5,7-dihydroxy-2-(4-hydroxyphenyl)- | 5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-4H-chromen-3-yl beta-D-glucopyranoside | Astragalin | CHEMBL233930 | cid_5282102 | kaempferol 3-O-glucoside |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H20O11 |
|---|
| Mol. Mass. | 448.3769 |
|---|
| SMILES | OC[C@H]1O[C@@H](Oc2c(O)c3c(cc(O)cc3=O)oc2-c2ccc(O)cc2)[C@H](O)[C@@H](O)[C@@H]1O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
