Reaction Details |
| Report a problem with these data |
Target | Riboflavin-binding protein |
---|
Ligand | BDBM22985 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_800332 (CHEMBL1948178) |
---|
pH | 7.4±n/a |
---|
Kd | 2100±n/a nM |
---|
Comments | extracted |
---|
Citation | Plantinga, A; Witte, A; Li, MH; Harmon, A; Choi, SK; Banaszak Holl, MM; Orr, BG; Baker, JR; Sinniah, K Bioanalytical Screening of Riboflavin Antagonists for Targeted Drug Delivery - A Thermodynamic and Kinetic Study. ACS Med Chem Lett2:363-367 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Riboflavin-binding protein |
---|
Name: | Riboflavin-binding protein |
Synonyms: | RBP | RBP_CHICK | Riboflavin-binding protein, plasma form | Riboflavin-binding protein, yolk major form | Riboflavin-binding protein, yolk minor form |
Type: | PROTEIN |
Mol. Mass.: | 27203.20 |
Organism: | Gallus gallus |
Description: | ChEMBL_800332 |
Residue: | 238 |
Sequence: | MLRFAITLFAVITSSTCQQYGCLEGDTHKANPSPEPNMHECTLYSESSCCYANFTEQLAH
SPIIKVSNSYWNRCGQLSKSCEDFTKKIECFYRCSPHAARWIDPRYTAAIQSVPLCQSFC
DDWYEACKDDSICAHNWLTDWERDESGENHCKSKCVPYSEMYANGTDMCQSMWGESFKVS
ESSCLCLQMNKKDMVAIKHLLSESSEESSSMSSSEEHACQKKLLKFEALQQEEGEERR
|
|
|
BDBM22985 |
---|
n/a |
---|
Name | BDBM22985 |
Synonyms: | Aralen | CHEMBL76 | CHLOROQUINE PHOSPHATE | Chlorochin | Chloroquine | Chloroquine, 17 | med.21724, Compound 8 | {4-[(7-chloroquinolin-4-yl)amino]pentyl}diethylamine |
Type | Antimalarial |
Emp. Form. | C18H26ClN3 |
Mol. Mass. | 319.872 |
SMILES | CCN(CC)CCCC(C)Nc1ccnc2cc(Cl)ccc12 |
Structure |
|