| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Riboflavin-binding protein |
|---|
| Ligand | BDBM22985 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_800332 (CHEMBL1948178) |
|---|
| pH | 7.4±n/a |
|---|
| Kd | 2100±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Plantinga, A; Witte, A; Li, MH; Harmon, A; Choi, SK; Banaszak Holl, MM; Orr, BG; Baker, JR; Sinniah, K Bioanalytical Screening of Riboflavin Antagonists for Targeted Drug Delivery - A Thermodynamic and Kinetic Study. ACS Med Chem Lett2:363-367 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Riboflavin-binding protein |
|---|
| Name: | Riboflavin-binding protein |
|---|
| Synonyms: | RBP | RBP_CHICK | Riboflavin-binding protein, plasma form | Riboflavin-binding protein, yolk major form | Riboflavin-binding protein, yolk minor form |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 27203.20 |
|---|
| Organism: | Gallus gallus |
|---|
| Description: | ChEMBL_800332 |
|---|
| Residue: | 238 |
|---|
| Sequence: | MLRFAITLFAVITSSTCQQYGCLEGDTHKANPSPEPNMHECTLYSESSCCYANFTEQLAH
SPIIKVSNSYWNRCGQLSKSCEDFTKKIECFYRCSPHAARWIDPRYTAAIQSVPLCQSFC
DDWYEACKDDSICAHNWLTDWERDESGENHCKSKCVPYSEMYANGTDMCQSMWGESFKVS
ESSCLCLQMNKKDMVAIKHLLSESSEESSSMSSSEEHACQKKLLKFEALQQEEGEERR
|
|
|
|---|
| BDBM22985 |
|---|
| n/a |
|---|
| Name | BDBM22985 |
|---|
| Synonyms: | Aralen | CHEMBL76 | CHLOROQUINE PHOSPHATE | Chlorochin | Chloroquine | Chloroquine, 17 | med.21724, Compound 8 | {4-[(7-chloroquinolin-4-yl)amino]pentyl}diethylamine |
|---|
| Type | Antimalarial |
|---|
| Emp. Form. | C18H26ClN3 |
|---|
| Mol. Mass. | 319.872 |
|---|
| SMILES | CCN(CC)CCCC(C)Nc1ccnc2cc(Cl)ccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
