| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50363529 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_801514 (CHEMBL1948441) |
|---|
| Ki | 5.5±n/a nM |
|---|
| Citation |  Wadsworth, H; Jones, PA; Chau, WF; Durrant, C; Fouladi, N; Passmore, J; O'Shea, D; Wynn, D; Morisson-Iveson, V; Ewan, A; Thaning, M; Mantzilas, D; Gausemel, I; Khan, I; Black, A; Avory, M; Trigg, W [¹¿?¿F]GE-180: a novel fluorine-18 labelled PET tracer for imaging Translocator protein 18 kDa (TSPO). Bioorg Med Chem Lett22:1308-13 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
|---|
| Type: | Mitochondrion membrane protein |
|---|
| Mol. Mass.: | 18945.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
|---|
| Residue: | 169 |
|---|
| Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
|---|
| BDBM50363529 |
|---|
| n/a |
|---|
| Name | BDBM50363529 |
|---|
| Synonyms: | CHEMBL1945417 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H27FN2O2 |
|---|
| Mol. Mass. | 346.439 |
|---|
| SMILES | CCN(CC)C(=O)C1CCCc2c1c1ccc(OC)cc1n2CCF |
|---|
| Structure | 
|
|---|
Search and Browse
