Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase III
LigandBDBM50366034
Substrate/Competitorn/a
Meas. Tech.ChEMBL_807325
Ki 570±n/a nM
Citation Carta FVullo DMaresca AScozzafava ASupuran CT New chemotypes acting as isozyme-selective carbonic anhydrase inhibitors with low affinity for the offtarget cytosolic isoform II. Bioorg Med Chem Lett 22:2182-5 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase III
Name:Carbonic Anhydrase III
Synonyms:CA-III | Carbonate dehydratase III | Carbonic anhydrase 3 (CA III) | Carbonic anhydrase III (CA III)
Type:Enzyme
Mol. Mass.:29562.11
Organism:Homo sapiens (Human)
Description:Human cloned isozyme.
Residue:260
Sequence:
MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTIL
NNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHL
VHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDP
SCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPL
VSNWRPPQPINNRVVRASFK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50366034
n/a
NameBDBM50366034
Synonyms:CHEMBL186422
TypeSmall organic molecule
Emp. Form.C9H7NO
Mol. Mass.145.158
SMILESO=c1ccc2ccccc2[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: