Reaction Details |
| Report a problem with these data |
Target | 5-hydroxytryptamine receptor 2A |
---|
Ligand | BDBM35254 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_2670 |
---|
Ki | 4±n/a nM |
---|
Citation | Campiani, G; Butini, S; Fattorusso, C; Catalanotti, B; Gemma, S; Nacci, V; Morelli, E; Cagnotto, A; Mereghetti, I; Mennini, T; Carli, M; Minetti, P; Di Cesare, MA; Mastroianni, D; Scafetta, N; Galletti, B; Stasi, MA; Castorina, M; Pacifici, L; Vertechy, M; Di Serio, S; Ghirardi, O; Tinti, O; Carminati, P Pyrrolo[1,3]benzothiazepine-based serotonin and dopamine receptor antagonists. Molecular modeling, further structure-activity relationship studies, and identification of novel atypical antipsychotic agents. J Med Chem47:143-57 (2003) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
5-hydroxytryptamine receptor 2A |
---|
Name: | 5-hydroxytryptamine receptor 2A |
Synonyms: | 5-HT-2A | 5-HT2 | 5-HT2A | 5-hydroxytryptamine receptor 2A (5-HT2A) | 5-hydroxytryptamine receptor 2A (5HT2A) | 5HT2A_RAT | Htr2 | Htr2a | Serotonin Receptor 2A |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 52852.05 |
Organism: | Rattus norvegicus (rat) |
Description: | Rat cortex membranes 5-HT2A receptors. |
Residue: | 471 |
Sequence: | MEILCEDNISLSSIPNSLMQLGDGPRLYHNDFNSRDANTSEASNWTIDAENRTNLSCEGY
LPPTCLSILHLQEKNWSALLTTVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAIWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VAFFIPLTIMVITYFLTIKSLQKEATLCVSDLSTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYAGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNENVIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENRKPLQLILVNTIPALAYK
SSQLQVGQKKNSQEDAEQTVDDCSMVTLGKQQSEENCTDNIETVNEKVSCV
|
|
|
BDBM35254 |
---|
n/a |
---|
Name | BDBM35254 |
Synonyms: | 2-methyl-4-(4-methylpiperazin-1-yl)-10H-thieno[2,3-b][1,5]benzodiazepine | CHEMBL715 | Olansek | US8802672, Olanzapine | Zyprexa | olanzapine |
Type | Small organic molecule |
Emp. Form. | C17H20N4S |
Mol. Mass. | 312.432 |
SMILES | CN1CCN(CC1)C1=Nc2ccccc2Nc2sc(C)cc12 |t:8| |
Structure |
|