Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50279829 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_79803 (CHEMBL696063) |
---|
IC50 | 121300±n/a nM |
---|
Citation | McLeod, DA; Brinkworth, RI; Ashley, JA; Janda, KD; Wirsching, P Phosphonamidates and phosphonamidate esters as HIV-1 protease inhibitors Bioorg Med Chem Lett1:653-658 (1991) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50279829 |
---|
n/a |
---|
Name | BDBM50279829 |
Synonyms: | ((S)-2-Carbamoyl-pyrrolidin-1-yl)-[2-phenyl-1-(2,2,2-trifluoro-acetylamino)-ethyl]-phosphinic acid anion |
Type | Small organic molecule |
Emp. Form. | C15H18F3N3O4P |
Mol. Mass. | 392.2906 |
SMILES | NC(=O)[C@@H]1CCCN1P([O-])(=O)C(Cc1ccccc1)NC(=O)C(F)(F)F |
Structure |
|