Reaction Details |
| Report a problem with these data |
Target | Leukotriene B4 receptor 1 |
---|
Ligand | BDBM50001611 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_98512 |
---|
Ki | 7.8±n/a nM |
---|
Citation | Scott Sawyer, J; Baldwin, RF; Froelich, LL; Saussy, DL; Jackson, WT Synthesis and pharmacologic activity of hydroxyacetophenone-substituted benzophenone/xanthone leukotriene B4 receptor antagonists Bioorg Med Chem Lett3:1981-1984 (1993) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Leukotriene B4 receptor 1 |
---|
Name: | Leukotriene B4 receptor 1 |
Synonyms: | BLT | BLT1 | BLTR | CMKRL1 | Chemoattractant receptor-like 1 | G-protein coupled receptor 16 | GPR16 | LT4R1_HUMAN | LTB4-R 1 | LTB4R | Leukotriene B4 R1 | Leukotriene B4 receptor | Leukotriene B4 receptor 1 | P2RY7 | P2Y purinoceptor 7 | P2Y7 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 37582.68 |
Organism: | Homo sapiens (Human) |
Description: | Q15722 |
Residue: | 352 |
Sequence: | MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNL
ALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVA
RPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAF
HLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVV
NLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF
VAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
|
|
|
BDBM50001611 |
---|
n/a |
---|
Name | BDBM50001611 |
Synonyms: | (E)-3-{3-(2-Carboxy-ethyl)-4-[6-(4-methoxy-phenyl)-hex-5-enyloxy]-benzoyl}-benzoic acid | (Z)-3-{3-(2-Carboxy-ethyl)-4-[6-(4-methoxy-phenyl)-hex-5-enyloxy]-benzoyl}-benzoic acid | 3-{3-(2-Carboxy-ethyl)-4-[(E)-6-(4-methoxy-phenyl)-hex-5-enyloxy]-benzoyl}-benzoic acid | 3-{3-(2-Carboxy-ethyl)-4-[6-(4-methoxy-phenyl)-hex-5-enyloxy]-benzoyl}-benzoic acid | 3-{3-(2-Carboxy-ethyl)-4-[6-(4-methoxy-phenyl)-hex-5-enyloxy]-benzoyl}-benzoic acid (BT223982) | CGS 23131 | CHEMBL49302 | LY-223982 |
Type | Small organic molecule |
Emp. Form. | C30H30O7 |
Mol. Mass. | 502.555 |
SMILES | COc1ccc(\C=C\CCCCOc2ccc(cc2CCC(O)=O)C(=O)c2cccc(c2)C(O)=O)cc1 |
Structure |
|