new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein kinase C, eta
LigandBDBM50285239
Substrate/Competitorn/a
Meas. Tech.ChEMBL_161127
IC50 2±n/a nM
Citation Lai YMendoza JHubbard FKalter K Synthesis and PKC inhibitory activities of balanol analogs with a cyclopentane substructure Bioorg Med Chem Lett 5:2155-2160 (1995)    Article
More Info.:Get all data from this article,  Assay Method
 
Protein kinase C, eta
Name:Protein kinase C, PKC; classical/novel
Synonyms:PKC-L | nPKC-eta
Type:Enzyme
Mol. Mass.:77844.26
Organism:Homo sapiens (Human)
Description:The recombinant human PKC enzymes were produced using a baculovirus expression system in SF9 cells
Residue:683
Sequence:
MSSGTMKFNGYLRVRIGEAVGLQPTRWSLRHSLFKKGHQLLDPYLTVSVDQVRVGQTSTK
QKTNKPTYNEEFCANVTDGGHLELAVFHETPLGYDHFVANCTLQFQELLRTTGASDTFEG
WVDLEPEGKVFVVITLTGSFTEATLQRDRIFKHFTRKRQRAMRRRVHQINGHKFMATYLR
QPTYCSHCREFIWGVFGKQGYQCQVCTCVVHKRCHHLIVTACTCQNNINKVDSKIAEQRF
GINIPHKFSIHNYKVPTFCDHCGSLLWGIMRQGLQCKICKMNVHIRCQANVAPNCGVNAV
ELAKTLAGMGLQPGNISPTSKLVSRSTLRRQGKESSKEGNGIGVNSSNRLGIDNFEFIRV
LGKGSFGKVMLARVKETGDLYAVKVLKKDVILQDDDVECTMTEKRILSLARNHPFLTQLF
CCFQTPDRLFFVMEFVNGGDLMFHIQKSRRFDEARARFYAAEIISALMFLHDKGIIYRDL
KLDNVLLDHEGHCKLADFGMCKEGICNGVTTATFCGTPDYIAPEILQEMLYGPAVDWWAM
GVLLYEMLCGHAPFEAENEDDLFEAILNDEVVYPTWLHEDATGILKSFMTKNPTMRLGSL
TQGGEHAILRHPFFKEIDWAQLNHRQIEPPFRPRIKSREDVSNFDPDFIKEEPVLTPIDE
GHLPMINQDEFRNFSYVSPELQP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50285239
n/a
NameBDBM50285239
Synonyms:4-(2-Carboxy-6-hydroxy-benzoyl)-3,5-dihydroxy-benzoic acid (3S,5R)-2-((S)-4-hydroxy-benzoylamino)-4-hydroxymethyl-cyclopentyl ester | CHEMBL306427
TypeSmall organic molecule
Emp. Form.C28H25NO11
Mol. Mass.551.4982
SMILESOC[C@H]1C[C@H](NC(=O)c2ccc(O)cc2)[C@@H](C1)OC(=O)c1cc(O)c(C(=O)c2c(O)cccc2C(O)=O)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: