new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein kinase C (PKC)
LigandBDBM50285237
Substrate/Competitorn/a
Meas. Tech.ChEBML_161464
IC50 12500±n/a nM
Citation Lai YMendoza JHubbard FKalter K Synthesis and PKC inhibitory activities of balanol analogs with a cyclopentane substructure Bioorg Med Chem Lett 5:2155-2160 (1995)    Article
More Info.:Get all data from this article,  Assay Method
 
Protein kinase C (PKC)
Name:Protein kinase C iota type/zeta type
Synonyms:Protein Kinase C, zeta | Protein kinase C zeta | Protein kinase C zeta (PKCζ) | Protein kinase C zeta type | Protein kinase C zeta type (PKC zeta) | Protein kinase C zeta type (PKCzeta) | nPKC-zeta
Type:Enzyme
Mol. Mass.:67649.13
Organism:Homo sapiens (Human)
Description:n/a
Residue:592
Sequence:
MPSRTGPKMEGSGGRVRLKAHYGGDIFITSVDAATTFEELCEEVRDMCRLHQQHPLTLKW
VDSEGDPCTVSSQMELEEAFRLARQCRDEGLIIHVFPSTPEQPGLPCPGEDKSIYRRGAR
RWRKLYRANGHLFQAKRFNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTC
RKHMDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDG
IKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTE
KHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEI
CIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAP
EILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRF
LSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQIT
DDYGLDNFDTQFTSEPVQLTPDDEDAIKRIDQSEFEGFEYINPLLLSTEESV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50285237
n/a
NameBDBM50285237
Synonyms:4-(2-Carboxy-6-hydroxy-benzoyl)-3,5-dihydroxy-benzoic acid (3S,5R)-4-hydroxy-2-((S)-4-hydroxy-benzoylamino)-cyclopentyl ester | CHEMBL67716
TypeSmall organic molecule
Emp. Form.C27H23NO11
Mol. Mass.537.4716
SMILESO[C@H]1C[C@H](NC(=O)c2ccc(O)cc2)[C@@H](C1)OC(=O)c1cc(O)c(C(=O)c2c(O)cccc2C(O)=O)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: