new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein kinase C delta type
LigandBDBM50285242
Substrate/Competitorn/a
Meas. Tech.ChEBML_160772
IC50 20±n/a nM
Citation Lai YMendoza JHubbard FKalter K Synthesis and PKC inhibitory activities of balanol analogs with a cyclopentane substructure Bioorg Med Chem Lett 5:2155-2160 (1995)    Article
More Info.:Get all data from this article,  Assay Method
 
Protein kinase C delta type
Name:Protein kinase C, PKC; classical/novel
Synonyms:PKC delta | Protein Kinase C- delta | nPKC-delta
Type:Enzyme
Mol. Mass.:77516.79
Organism:Homo sapiens (Human)
Description:The recombinant human PKC enzymes were produced using a baculovirus expression system in SF9 cells
Residue:676
Sequence:
MAPFLRIAFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFD
AHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQY
FLEDVDCKQSMRSEDEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKDFVW
GLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTIFQKERFNIDMPHRFKVHNYMS
PTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRASR
RSDSASSEPVGIYQGFEKKTGVAGEDMQDNSGTYGKIWEGSSKCNINNFIFHKVLGKGSF
GKVLLGELKGRGEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTK
DHLFFVMEFLNGGDLMYHIQDKGRFELYRATFYAAEIMCGLQFLHSKGIIYRDLKLDNVL
LDRDGHIKIADFGMCKENIFGESRASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLYE
MLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIH
PFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAF
AGFSFVNPKFEHLLED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50285242
n/a
NameBDBM50285242
Synonyms:4-(2-Carboxy-6-hydroxy-benzoyl)-3,5-dihydroxy-benzoic acid (3R,5R)-4-aminomethyl-2-((S)-4-hydroxy-benzoylamino)-cyclopentyl ester | CHEMBL67290
TypeSmall organic molecule
Emp. Form.C28H26N2O10
Mol. Mass.550.5134
SMILESNC[C@@H]1C[C@H](NC(=O)c2ccc(O)cc2)[C@@H](C1)OC(=O)c1cc(O)c(C(=O)c2c(O)cccc2C(O)=O)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: