| Reaction Details |
|---|
 | Report a problem with these data |
| Target | HLA class II histocompatibility antigen, DR beta 3 chain |
|---|
| Ligand | BDBM50287626 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_47860 |
|---|
| IC50 | 180±n/a nM |
|---|
| Citation |  Hanson, GJ; Vuletich, JL; Bedell, LJ; Bono, CP; Howard, SC; Welply, JK; Woulfe, SL; Zacheis, ML Design of MHC class II (DR4) ligands using conformationally restricted imino acids at p3 and p5 Bioorg Med Chem Lett6:1931-1936 (1996) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| HLA class II histocompatibility antigen, DR beta 3 chain |
|---|
| Name: | HLA class II histocompatibility antigen, DR beta 3 chain |
|---|
| Synonyms: | DRB3_HUMAN | HLA class II histocompatibility antigen DRB3-1 | HLA class II histocompatibility antigen, DRB3-1 beta chain | HLA-DRB3 | Human leukocyte antigen DR beta chain | MHC class I antigen DRB3*1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 29969.73 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_47860 |
|---|
| Residue: | 266 |
|---|
| Sequence: | MVCLKLPGGSSLAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGTERVRYLDRYF
HNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTV
QRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNG
DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSALTVEWRARSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFRNQKGHSGLQPTGFLS
|
|
|
|---|
| BDBM50287626 |
|---|
| n/a |
|---|
| Name | BDBM50287626 |
|---|
| Synonyms: | (S)-2-((2S,3R)-2-{(S)-2-[(S)-2-((S)-2-{(S)-2-[(S)-2-Acetylamino-3-(4-hydroxy-phenyl)-propionylamino]-5-guanidino-pentanoylamino}-propionylamino)-4-methylsulfanyl-butyrylamino]-propionylamino}-3-hydroxy-butyrylamino)-4-methyl-pentanoic acid amide | CHEMBL291311 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C38H63N11O10S |
|---|
| Mol. Mass. | 866.04 |
|---|
| SMILES | CSCC[C@H](NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](Cc1ccc(O)cc1)NC(C)=O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(N)=O |
|---|
| Structure | 
|
|---|
Search and Browse
