| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50288954 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_201726 |
|---|
| Ki | 30±n/a nM |
|---|
| Citation |  Kassiou, M; Nguyen, VH; Knott, R; Christie, MJ; Hambley, TW Trishomocubanes, a new class of selective and high affinity ligands for the sigma binding site Bioorg Med Chem Lett6:595-600 (1996) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25124.85 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99720 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50288954 |
|---|
| n/a |
|---|
| Name | BDBM50288954 |
|---|
| Synonyms: | 11-benzyl-11-azahexacyclo[5.4.1.02,6.03,10.04,8.09,12]dodecan-1-ol; hydrochloride | CHEMBL1189234 | CHEMBL538300 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H19NO |
|---|
| Mol. Mass. | 265.3496 |
|---|
| SMILES | OC12C3C4C5C3C(C3C5CC4C13)N2Cc1ccccc1 |TLB:3:2:12:11.7,4:5:12:11.7,10:11:12:2.5,8:7:12:2.5,THB:13:12:11.7:2.5| |
|---|
| Structure | 
|
|---|
Search and Browse
