new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M1
LigandBDBM39341
Substrate/Competitorn/a
Meas. Tech.ChEBML_139961
Ki 5.2±n/a nM
Citation Hudkins RLDeHaven-Hudkins DLDoukas P Design of dual acting anticonvulsant-antimuscarinic succinimide and hydantoin derivatives Bioorg Med Chem Lett 7:979-984 (1997)    Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M1
Name:Muscarinic receptor M1 and M2
Synonyms:Cholinergic, muscarinic M1 | Chrm-1 | Chrm1 | cholinergic receptor, muscarinic 1
Type:Enzyme Catalytic Domain
Mol. Mass.:51390.46
Organism:RAT
Description:Cholinergic, muscarinic M1 CHRM1 RAT::P08482
Residue:460
Sequence:
MNTSVPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPESPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
VIKMPMVDSEAQAPTKQPPKSSPNTVKRPTKKGRDRGGKGQKPRGKEQLAKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTVNPMCYAL
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM39341
n/a
NameBDBM39341
Synonyms:11-[(4-methylpiperazin-1-yl)acetyl]-5,11-dihydro-6H-pyrido[2,3-b][1,4]benzodiazepin-6-one | 11-[2-(4-methyl-1-piperazinyl)-1-oxoethyl]-5H-pyrido[2,3-b][1,4]benzodiazepin-6-one;hydrochloride | 11-[2-(4-methylpiperazin-1-yl)acetyl]-5H-pyrido[2,3-b][1,4]benzodiazepin-6-one;hydrochloride | 11-[2-(4-methylpiperazin-1-yl)ethanoyl]-5H-pyrido[2,3-b][1,4]benzodiazepin-6-one;hydrochloride | 11-[2-(4-methylpiperazino)acetyl]-5H-pyrido[2,3-b][1,4]benzodiazepin-6-one;hydrochloride | CHEMBL9967 | MLS000069702 | PIRENZEPINE | PIRENZEPINE DIHYDROCHLORIDE | SMR000058502 | cid_185248
TypeSmall organic molecule
Emp. Form.C19H21N5O2
Mol. Mass.351.4023
SMILESCN1CCN(CC(=O)N2c3ccccc3C(=O)Nc3cccnc23)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: