| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50000655 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_221923 |
|---|
| Ki | 52±n/a nM |
|---|
| Citation |  Wang, C; McFadyen, IJ; Traynor, JR; Mosberg, HI Design of a high affinity peptidomimetic opioid agonist from peptide pharmacophore models. Bioorg Med Chem Lett8:2685-8 (1999) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50000655 |
|---|
| n/a |
|---|
| Name | BDBM50000655 |
|---|
| Synonyms: | (4R,7S,10R)-10-[(S)-2-Amino-3-(4-hydroxy-phenyl)-propionylamino]-7-benzyl-3,3-dimethyl-6,9-dioxo-1,2-dithia-5,8-diaza-cycloundecane-4-carboxylic acid | 10-[2-Amino-3-(4-hydroxy-phenyl)-propionylamino]-7-benzyl-3,3-dimethyl-6,9-dioxo-1,2-dithia-5,8-diaza-cycloundecane-4-carboxylic acid | CHEMBL39192 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H32N4O6S2 |
|---|
| Mol. Mass. | 560.685 |
|---|
| SMILES | CC1(C)SSC[C@H](NC(=O)[C@@H](N)Cc2ccc(O)cc2)C(=O)N[C@@H](Cc2ccccc2)C(=O)N[C@@H]1C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
