Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDelta-type opioid receptor
LigandBDBM50451004
Substrate/Competitorn/a
Meas. Tech.ChEMBL_217731
EC50 28±n/a nM
Citation Husbands SMBreeden SWGrivas KLewis JW Ring constrained analogues of the orvinols: the furanomorphides. Bioorg Med Chem Lett 9:831-4 (1999) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Delta-type opioid receptor
Name:Opioid receptors; mu/kappa/delta
Synonyms:D-OR-1 | DOR-1 | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRK1 | opioid receptor, delta 1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:40382.98
Organism:Homo sapiens (Human)
Description:Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor.
Residue:372
Sequence:
MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50451004
n/a
NameBDBM50451004
Synonyms:CHEMBL2110315
TypeSmall organic molecule
Emp. Form.C25H33NO3
Mol. Mass.395.5344
SMILES[H][C@@]12C[C@]34CC[C@]1(OC(C)(C)C2(C)C)[C@]1([H])Oc2c5c(CC3N(C)CC[C@@]415)ccc2O |r,TLB:23:22:3:18.19.20,THB:11:1:26.14:5.4|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: