| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50101160 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_145277 (CHEMBL751213) |
|---|
| Ki | 0.410000±n/a nM |
|---|
| Citation |  Wentland, MP; Lou, R; Dehnhardt, CM; Duan, W; Cohen, DJ; Bidlack, JM 3-Carboxamido analogues of morphine and naltrexone. synthesis and opioid receptor binding properties. Bioorg Med Chem Lett11:1717-21 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50101160 |
|---|
| n/a |
|---|
| Name | BDBM50101160 |
|---|
| Synonyms: | 3-Cyclopropylmethyl-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocine-8-carboxylic acid amide | CHEMBL297428 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H26N2O |
|---|
| Mol. Mass. | 298.4225 |
|---|
| SMILES | CC1C2Cc3ccc(cc3C1(C)CCN2CC1CC1)C(N)=O |TLB:8:9:1:14.13.12,15:14:1:4.9.3| |
|---|
| Structure | 
|
|---|
Search and Browse
