| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50101159 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_145276 |
|---|
| Ki | 5800±n/a nM |
|---|
| Citation |  Wentland, MP; Lou, R; Dehnhardt, CM; Duan, W; Cohen, DJ; Bidlack, JM 3-Carboxamido analogues of morphine and naltrexone. synthesis and opioid receptor binding properties. Bioorg Med Chem Lett11:1717-21 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50101159 |
|---|
| n/a |
|---|
| Name | BDBM50101159 |
|---|
| Synonyms: | 4,10N,10N-trimethyl-14-hydroxy-(1S,5R,17R)-12-oxa-4-azapentacyclo[9.6.1.01,13.05,17.07,18]octadeca-7,9,11(18),15-tetraene-10-carboxamide | CHEMBL50386 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H24N2O3 |
|---|
| Mol. Mass. | 340.4162 |
|---|
| SMILES | CN(C)C(=O)c1ccc2C[C@@H]3[C@@H]4C=CC(O)C5Oc1c2[C@]45CCN3C |c:12| |
|---|
| Structure | 
|
|---|
Search and Browse
