| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM2898 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_140632 |
|---|
| IC50 | 31±n/a nM |
|---|
| Citation |  Corbett, JW; Kresge, KJ; Pan, S; Cordova, BC; Klabe, RM; Rodgers, JD; Erickson-Viitanen, SK Trifluoromethyl-containing 3-alkoxymethyl- and 3-aryloxymethyl-2-pyridinones are potent inhibitors of HIV-1 non-nucleoside reverse transcriptase. Bioorg Med Chem Lett11:309-12 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM2898 |
|---|
| n/a |
|---|
| Name | BDBM2898 |
|---|
| Synonyms: | (4S)-6-chloro-4-(2-cyclopropylethynyl)-4-(trifluoromethyl)-1,2,3,4-tetrahydroquinazolin-2-one | CHEMBL283619 | DPC961 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H10ClF3N2O |
|---|
| Mol. Mass. | 314.69 |
|---|
| SMILES | FC(F)(F)[C@]1(NC(=O)Nc2ccc(Cl)cc12)C#CC1CC1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
