| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protein Tat |
|---|
| Ligand | BDBM50097336 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_209907 (CHEMBL811911) |
|---|
| Kd | 290±n/a nM |
|---|
| Citation |  Hamasaki, K; Ueno, A Aminoglycoside antibiotics, neamine and its derivatives as potent inhibitors for the RNA-protein interactions derived from HIV-1 activators. Bioorg Med Chem Lett11:591-4 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protein Tat |
|---|
| Name: | Protein Tat |
|---|
| Synonyms: | Human immunodeficiency virus type 1 Tat protein | Protein Tat | TAT_HV112 | Transactivating regulatory protein | tat |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 9771.75 |
|---|
| Organism: | Human immunodeficiency virus type 1 (isolate PCV12 group M subtype B)(HIV-1) |
|---|
| Description: | ChEMBL_199318 |
|---|
| Residue: | 86 |
|---|
| Sequence: | MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGRKKRRQRRRAPQ
GSQTHQVSLSKQPTSQSRGDPTGPKE
|
|
|
|---|
| BDBM50097336 |
|---|
| n/a |
|---|
| Name | BDBM50097336 |
|---|
| Synonyms: | CHEMBL152397 | Pyrene-1-carboxylic acid [(4R,5S,6S)-5-amino-6-((2R,3R,4R)-4,6-diamino-2,3-dihydroxy-cyclohexyloxy)-3,4-dihydroxy-tetrahydro-pyran-2-ylmethyl]-amide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H34N4O7 |
|---|
| Mol. Mass. | 550.6029 |
|---|
| SMILES | NC1CC(N)C(OC2OC(CNC(=O)c3ccc4ccc5cccc6ccc3c4c56)C(O)C(O)C2N)C(O)C1O |
|---|
| Structure | 
|
|---|
Search and Browse
