| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protein Rev |
|---|
| Ligand | BDBM8580 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_164495 (CHEMBL771472) |
|---|
| IC50 | 21000±n/a nM |
|---|
| Citation |  Hamasaki, K; Ueno, A Aminoglycoside antibiotics, neamine and its derivatives as potent inhibitors for the RNA-protein interactions derived from HIV-1 activators. Bioorg Med Chem Lett11:591-4 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protein Rev |
|---|
| Name: | Protein Rev |
|---|
| Synonyms: | Human immunodeficiency virus type 1 REV | REV_HV1H2 | rev |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 13078.11 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | ChEMBL_79479 |
|---|
| Residue: | 116 |
|---|
| Sequence: | MAGRSGDSDEELIRTVRLIKLLYQSNPPPNPEGTRQARRNRRRRWRERQRQIHSISERIL
GTYLGRSAEPVPLQLPPLERLTLDCNEDCGTSGTQGVGSPQILVESPTVLESGTKE
|
|
|
|---|
| BDBM8580 |
|---|
| n/a |
|---|
| Name | BDBM8580 |
|---|
| Synonyms: | (2R,3S,4R,5R,6R)-5-amino-2-(aminomethyl)-6-{[(1R,2R,3S,4R,6S)-4,6-diamino-2,3-dihydroxycyclohexyl]oxy}oxane-3,4-diol | Neamine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H26N4O6 |
|---|
| Mol. Mass. | 322.358 |
|---|
| SMILES | NC[C@H]1O[C@H](O[C@@H]2[C@@H](N)C[C@@H](N)[C@H](O)[C@H]2O)[C@H](N)[C@@H](O)[C@@H]1O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
