Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-HT2
LigandBDBM50115715
Substrate/Competitorn/a
Meas. Tech.ChEBML_2547
Ki 610±n/a nM
Citation Bergauer MHübner HGmeiner P 2,4-Disubstituted pyrroles: synthesis, traceless linking and pharmacological investigations leading to the dopamine D4 receptor partial agonist FAUC 356. Bioorg Med Chem Lett 12:1937-40 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
5-HT2
Name:Serotonin 2a (5-HT2a) receptor
Synonyms:5-HT-2 | 5-HT-2A | 5-HT2A
Type:Enzyme Catalytic Domain
Mol. Mass.:52679.13
Organism:PIG
Description:5-HT2 0 0::P50129
Residue:470
Sequence:
MDVLCEENTSLSSPTNSFMQLNDDTRLYHNDFNSGEANTSDAFNWTVDSENRTNLSCEGC
LSPPCFSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHRRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGAL
LNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYKS
SQLQTGQKENSKQDDKATENDCTMVALGKQHSEDAPADNSNTVNEKVSCV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50115715
n/a
NameBDBM50115715
Synonyms:5-(4-Phenyl-piperazin-1-ylmethyl)-1H-pyrrole-3-carbonitrile | CHEMBL56118
TypeSmall organic molecule
Emp. Form.C16H18N4
Mol. Mass.266.3409
SMILESN#Cc1c[nH]c(CN2CCN(CC2)c2ccccc2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: