| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50130955 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_54391 (CHEMBL668775) |
|---|
| IC50 | 302±n/a nM |
|---|
| Citation |  Zolli-Juran, M; Cechetto, JD; Hartlen, R; Daigle, DM; Brown, ED High throughput screening identifies novel inhibitors of Escherichia coli dihydrofolate reductase that are competitive with dihydrofolate. Bioorg Med Chem Lett13:2493-6 (2003) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | Dihydrofolate reductase (F31V) | dfrA17 |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 17532.46 |
|---|
| Organism: | Escherichia coli |
|---|
| Description: | n/a |
|---|
| Residue: | 157 |
|---|
| Sequence: | MKISLISAVSESGVIGSGPDIPWSVKGEQLLFKALTYNQWLLVGRKTFDSMGVLPNRKYA
VVSKNGISSSNENVLVFPSIENALKELSKVTDHVYVSGGGQIYNSLIEKADIIHLSTVHV
EVEGDIKFPIMPENFNLVFEQFFMSNINYTYQIWKKG
|
|
|
|---|
| BDBM50130955 |
|---|
| n/a |
|---|
| Name | BDBM50130955 |
|---|
| Synonyms: | 3-amino-1-{[4-({[[(aminocarbonothioyl)amino](iminio)methyl]amino}methyl)-2,5-dimethylbenzyl]amino}-3-thioxopropan-1-iminium |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H25N7S2 |
|---|
| Mol. Mass. | 367.535 |
|---|
| SMILES | Cc1cc(CNC(=[NH2+])CC(N)=S)c(C)cc1CNC(=N)NC(N)=[SH+] |
|---|
| Structure | 
|
|---|
Search and Browse
