| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase |
|---|
| Ligand | BDBM50125056 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_52541 |
|---|
| Ki | 240000000±n/a nM |
|---|
| Citation |  Lillo, AM; Tetzlaff, CN; Sangari, FJ; Cane, DE Functional expression and characterization of EryA, the erythritol kinase of Brucella abortus, and enzymatic synthesis of L-erythritol-4-phosphate. Bioorg Med Chem Lett13:737-9 (2003) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase |
|---|
| Name: | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase |
|---|
| Synonyms: | Cytidylyltransferase | ISPD_ECOL6 | ispD |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 25781.06 |
|---|
| Organism: | Escherichia coli O6 |
|---|
| Description: | ChEMBL_52541 |
|---|
| Residue: | 236 |
|---|
| Sequence: | MATTHLDVCAVVPAAGFGRRMQTECPKQYLSIGNQTILEHSVHALLAHPRVKRVVIAISP
GDSRFAQLPLANHPRITVVDGGEERADSVLAGLKAAGDAQWVLVHDAARPCLHQDDLARL
LALSETSRTGGILAAPVRDTMKRAEPGKNAIAHTVDRNGLWHALTPQFFPRELLHDCLTR
ALNEGATITDEASALEYCGFHPQLVEGRADNIKVTRPEDLALAEFYLTRTIHQENT
|
|
|
|---|
| BDBM50125056 |
|---|
| n/a |
|---|
| Name | BDBM50125056 |
|---|
| Synonyms: | Phosphoric acid mono-(2,3,4-trihydroxy-3-methyl-butyl) ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C5H11O7P |
|---|
| Mol. Mass. | 214.1115 |
|---|
| SMILES | C[C@@](O)(CO)[C@@H](O)COP([O-])([O-])=O |
|---|
| Structure | 
|
|---|
Search and Browse
