Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytidylyltransferase
LigandBDBM50125056
Substrate/Competitorn/a
Meas. Tech.ChEBML_52541
Ki 240000000±n/a nM
Citation Lillo AMTetzlaff CNSangari FJCane DE Functional expression and characterization of EryA, the erythritol kinase of Brucella abortus, and enzymatic synthesis of L-erythritol-4-phosphate. Bioorg Med Chem Lett 13:737-9 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Cytidylyltransferase
Name:Cytidylyltransferase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:25781.06
Organism:Escherichia coli O6
Description:ChEMBL_52541
Residue:236
Sequence:
MATTHLDVCAVVPAAGFGRRMQTECPKQYLSIGNQTILEHSVHALLAHPRVKRVVIAISP
GDSRFAQLPLANHPRITVVDGGEERADSVLAGLKAAGDAQWVLVHDAARPCLHQDDLARL
LALSETSRTGGILAAPVRDTMKRAEPGKNAIAHTVDRNGLWHALTPQFFPRELLHDCLTR
ALNEGATITDEASALEYCGFHPQLVEGRADNIKVTRPEDLALAEFYLTRTIHQENT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50125056
n/a
NameBDBM50125056
Synonyms:Phosphoric acid mono-(2,3,4-trihydroxy-3-methyl-butyl) ester
TypeSmall organic molecule
Emp. Form.C5H11O7P
Mol. Mass.214.1115
SMILESC[C@@](O)(CO)[C@@H](O)COP([O-])([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: