Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNociceptin receptor
LigandBDBM50137563
Substrate/Competitorn/a
Meas. Tech.ChEBML_144660
Ki 535±n/a nM
Citation Jong LZaveri NToll L The design and synthesis of a novel quinolizidine template for potent opioid and opioid receptor-like (ORL1, NOP) receptor ligands. Bioorg Med Chem Lett 14:181-5 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Nociceptin receptor
Name:Nociceptin receptor
Synonyms:KOR-3 | Kappa-type 3 opioid receptor | Mu-type opioid receptor (Mu) | NOP | Nociceptin Receptor (ORL1 Receptor) | Nociceptin receptor (NOP) | Nociceptin receptor (ORL-1) | Nociceptin receptor (ORL1) | Nociceptin/Orphanin FQ, NOP receptor | OPIATE ORL-1 | OPRL1 protein | ORL1 receptor | Opioid receptor like-1 | Orphanin FQ receptor | Orphanin FQ receptor (ORL1) | P41146
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:40702.87
Organism:Homo sapiens (Human)
Description:P41146
Residue:370
Sequence:
MEPLFPAPFWEVIYGSHLQGNLSLLSPNHSLLPPHLLLNASHGAFLPLGLKVTIVGLYLA
VCVGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGN
ALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASV
VGVPVAIMGSAQVEDEEIECLVEIPTPQDYWGPVFAICIFLFSFIVPVLVISVCYSLMIR
RLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLAQGLGVQPSSETAVAI
LRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALRRDVQVSDRVRSIAKDVALAC
KTSETVPRPA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50137563
n/a
NameBDBM50137563
Synonyms:1-Ethyl-3-((2S,6S,9aR)-6-phenyl-octahydro-quinolizin-2-yl)-1,3-dihydro-benzoimidazol-2-one | CHEMBL299660 | SR-14137
TypeSmall organic molecule
Emp. Form.C24H29N3O
Mol. Mass.375.5066
SMILESCCn1c2ccccc2n([C@H]2CCN3[C@H](CCC[C@H]3c3ccccc3)C2)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: