| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50367062 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_76213 |
|---|
| IC50 | 94±n/a nM |
|---|
| Citation |  Ramakrishnan, K; Portoghese, PS Synthesis and biological evaluation of a metazocine-containing enkephalinamide. Evidence for nonidentical roles of the tyramine moiety in opiates and opioid peptides. J Med Chem25:1423-7 (1983) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50367062 |
|---|
| n/a |
|---|
| Name | BDBM50367062 |
|---|
| Synonyms: | METAZOCINE |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H21NO |
|---|
| Mol. Mass. | 231.3333 |
|---|
| SMILES | C[C@H]1[C@@H]2Cc3ccc(O)cc3[C@]1(C)CCN2C |THB:16:15:1:4.10.3| |
|---|
| Structure | 
|
|---|
Search and Browse
